This recombinant full-length human isocitrate dehydrogenase (IDH1) variant was produced in E. coli and contains an Arg to His substitution at residue 132 (R132H).
Isocitrate dehydrogenases (IDH) catalyzes the oxidative decarboxylation of isocitrate, producing alpha-ketoglutarate and CO2. Specific mutations in the isocitrate dehydrogenase gene isocitrate dehydrogenase 1 (IDH1) have been found in several brain tumors including astrocytoma, oligodendroglioma and glioblastoma multiforme, with mutations found in nearly all cases of secondary glioblastomas. Specifically, mutations at Arg 132 have been shown to result in a new ability of the enzyme to catalyze the NADPH-dependent reduction of alpha-ketoglutarate to R(-)-2-hydroxyglutarate (2HG). Excess accumulation of 2HG has been shown to lead to an elevated risk of malignant brain tumors in patients with inborn errors of 2HG metabolism.
Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
---|
Product Type: | Protein |
Name: | Isocitrate Dehydrogenase 1 (IDH1)-(R132H variant)-8xHis |
Accession ID: | O75874 |
Source: | Human protein expressed in E.Coli Rosetta (DE3) |
Molecular Weight: | 48,067 Da |
Amino Acid Sequence: | MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIG(R>H)CHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKSLEHHHHHHHH |
Fusion Tag(s): | Contains C-terminal 8xHis tag |
Purity: | >98% as determined by SDS-PAGE |
Buffer: | 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 5 mM BME, 10% glycerol |
Storage: | -80C |
Shipped: | Dry ice |
Theoretical pI: 6.53
Extinction coefficient: 63830
A280: 1.328
SDS-PAGE Analysis
If you publish research with this product, please let us know so we can cite your paper.