Histone H4 (N-term 6xHis-tag, human recombinant)
Human recombinant histones offered by Xtal are expressed in E. coli, refolded from inclusion bodies, and purified by size exclusion and ion-exchange chromatography.
Human recombinant histones offered by Xtal are expressed in E. coli, refolded from inclusion bodies, and purified by size exclusion and ion-exchange chromatography.
Specifications
| Product Type: | Protein |
| Source: | Expressed in E.Coli Rosetta (DE3), refolded from inclusion bodies, and purified by size exclusion and ion-exchange chromatography |
| Molecular Weight: | 13,399 Da |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
| Format: | 1mg/mL in water containing 2 mM Β Mercaptoethanol |
| Purity: | >98% as determined by SDS-PAGE |
| Solubility: | Can be further diluted in all common buffers (e.g., Hepes, Tris, etc.) |
| Comments: | Human protein expressed recombinantly in E. coli |
| Storage: | The protein is stored for long-term at -80 °C |
| Shipped: | Dry ice |
Comments
Theoretical pI: 11.95
Extinction coefficient: 3888
A280: 0.25
References
- Vergani et al. Protein Expression and Purification 24, 420-428 (2002).
If you publish research with this product, please let us know so we can cite your paper.
