Human Vitronectin N-GST (heparin-binding domain)
This recombinant VN fragment corresponds to the heparin-binding domain (amino acids A341-A380). Several studies using overlapping peptides have provided consistent evidence that amino acids 341–370 constitute a significant proportion of vitronectin’s heparin binding activity. It is expressed as a GST-tagged fusion protein in E. coli, liberated from inclusion bodies by urea treatment, and purified over heparin–agarose.
Vitronectin (VN) is a 75-kDa adhesive glycoprotein that also plays a role in regulating several proteolytic enzyme cascades including complement, thrombosis, and fibrinolysis. Several distinct, biologically active conformations of VN are known to exist. In the blood, VN circulates in a monomeric form. High molecular mass oligomers of VN are found within the extracellular matrix (ECM)1 and in platelet releasate. The interaction of vitronectin with thrombin–antithrombin III complexes, plasminogen activator inhibitor, or with chemical or thermal denaturants results in conformational changes that lead to VN multimerization. These conformational changes may be important for VN activity as the multimeric form of VN preferentially binds to v 3 and IIb 3 integrins, urokinase receptors, plasminogen activator inhibitor, and glycosaminoglycans. The interaction of multimeric VN with these ligands affects a number of functions including cell adhesion and spreading, cell migration, inflammation, and hemostasis.
From the laboratory of Denise C. Hocking, PhD, University of Rochester Medical Center.
Part of The Investigator's Annexe program.
This recombinant VN fragment corresponds to the heparin-binding domain (amino acids A341-A380). Several studies using overlapping peptides have provided consistent evidence that amino acids 341–370 constitute a significant proportion of vitronectin’s heparin binding activity. It is expressed as a GST-tagged fusion protein in E. coli, liberated from inclusion bodies by urea treatment, and purified over heparin–agarose.
Vitronectin (VN) is a 75-kDa adhesive glycoprotein that also plays a role in regulating several proteolytic enzyme cascades including complement, thrombosis, and fibrinolysis. Several distinct, biologically active conformations of VN are known to exist. In the blood, VN circulates in a monomeric form. High molecular mass oligomers of VN are found within the extracellular matrix (ECM)1 and in platelet releasate. The interaction of vitronectin with thrombin–antithrombin III complexes, plasminogen activator inhibitor, or with chemical or thermal denaturants results in conformational changes that lead to VN multimerization. These conformational changes may be important for VN activity as the multimeric form of VN preferentially binds to v 3 and IIb 3 integrins, urokinase receptors, plasminogen activator inhibitor, and glycosaminoglycans. The interaction of multimeric VN with these ligands affects a number of functions including cell adhesion and spreading, cell migration, inflammation, and hemostasis.
From the laboratory of Denise C. Hocking, PhD, University of Rochester Medical Center.
Part of The Investigator's Annexe program.
| Product Type: | Protein |
| Name: | Recombinant Human Vitronectin (heparin-binding domain); amino acids A341-A380 |
| Accession ID: | P04004 |
| Source: | Human protein expressed in E. coli DH5 alpha carrying the cloned gene in pGEX-2T |
| Molecular Weight: | 31293.1 Da |
| Amino Acid Sequence: | APRPSLTKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRA |
| Fusion Tag(s): | GST, N-terminal |
| Purity: | >90% by SDS-PAGE |
| Buffer: | Solution in PBS |
| Concentration: | 2.5mg/mL |
| Storage: | Store at -80C |
| Shipped: | Dry ice |
 |
| Schematic of recombinant vitronectins and fusion proteins. Regions subjected to modification are aligned for comparison, with the pertinent residue numbers indicated across the top. rVn represents the recombinant wildtype form of vitronectin. rVn delta 347358 is a fulllength form of recombinant vitronectin containing a deletion of residues K347G358 within the heparin binding domain. Adapted from: Wilkins-Port, C.E., Sanderson, R.D., Tominna-Sebald, E.T., and McKeown-Longo, P.J. (2003) Vitronectin's basic domain is a syndecan ligand which functions in trans to regulate vitronectin turnover. Cell Commun. Adhes. 10: 85-103 |
- Hocking,D.C., Sottile,J., Reho, T., Fassler, R., and McKeown-Lonngo, P.J. (1999) Inhibition of fibronectin matrix assembly by the heparin-binding domain of vitronectin. J. Biol. Chem. 274:27257-27273.
If you publish research with this product, please let us know so we can cite your paper.
