This rabbit polyclonal antibody was generated against GST-fusion protein containing a 77 amino acid region of mouse hemojuvelin (HJV) and recognizes human and mouse HJV.
Highlights:
Hemojuvelin (HJV), also known as repulsive guidance molecule C (RGMc) or hemochromatosis type 2 protein (HFE2), is a member of the repulsive guidance molecule family of proteins. The protein in mammals is membrane-bound and soluble and is responsible for the iron overload condition known as juvenile hemochromatosis in humans, a severe form of hemochromatosis.
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
Product Type: | Antibody |
Antigen: | Mouse HFE2 |
Accession ID: | Q7TQ32, Q6ZVN8 |
Molecular Weight: | 50 kDa |
Clonality: | Polyclonal |
Reactivity: | Human and Mouse |
Immunogen: | GST-fusion protein containing a 77 amino acid region of mouse HFE2 |
Species Immunized: | Rabbit |
Epitope: | RQTAGQLSFSIRVAEDVARAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAIAIDTARRLCKEGLPVEDAYFQSCVFD |
Purification Method: | To remove antibodies that were generated against the GST moiety, serum was purified by absorption through an affinity column of immobilized GST (Pierce) |
Buffer: | Serum with 0.05% sodium azide |
Tested Applications: | WB (1:2000) |
Storage: | -80C |
Shipped: | Cold Packs (Domestic, Overnight); Dry Ice (International) |
If you publish research with this product, please let us know so we can cite your paper.