Anti-Ferroportin (SLC40A1) Antibody

This rabbit polyclonal antibody was generated against GST-fusion protein containing 4 tandem copies of the C-terminal 32 amino acid domain of mouse ferroportin (FPN) and is specific for mouse FPN .

Highlights:

  • Reacts with mouse FPN
  • Binds to the epitope RFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV
  • Suitable for Western Blot and Immunohistochemistry applications

Ferroportin also known as solute carrier family 40 member 1 (SLC40A1) is a transmembrane protein that transports iron from the inside of a cell to the outside of the cell. It also plays a role in transferring iron between maternal and fetal circulation. The protein mediates iron efflux in the presence of a ferroxidase (hephaestin and/or ceruloplasmin).

From the laboratory of Kostas Pantopoulos, PhD, McGill University.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
EMG009
Anti-Ferroportin (SLC40A1) Antibody
100uL In stock
Regular Price:$355.00
On Sale:
Specifications

Product Type: Antibody
Antigen: Mouse FPN
Accession ID: Q9NP59
Molecular Weight: 63 kDa
Clonality: Polyclonal
Reactivity: Mouse
Immunogen: GST-fusion protein containing 4 tandem copies of the C-terminal 32 amino acid domain of mouse Fpn
Species Immunized: Rabbit
Epitope: RFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV
Purification Method: To remove antibodies that were generated against the GST moiety, serum was purified by absorption through an affinity column of immobilized GST (Pierce)
Buffer: Serum with 0.05% sodium azide
Tested Applications: WB (1:1000), IHC (1:500)
Storage: -80C
Shipped: Cold Packs (Domestic, Overnight); Dry Ice (International)

Provider
From the laboratory of Kostas Pantopoulos, PhD, McGill University.
References
  1. Schümann K, Herbach N, Kerling C, Seifert M, Fillebeen C, Prysch I, Reich J, Weiss G, Pantopoulos K. Iron absorption and distribution in TNF(DeltaARE/+) mice, a model of chronic inflammation. J Trace Elem Med Biol. 2010 Jan;24(1):58-66.
  2. Wilkinson N, Pantopoulos K. IRP1 regulates erythropoiesis and systemic iron homeostasis by controlling HIF2? mRNA translation. Blood. 2013 Aug 29;122(9):1658-68.

If you publish research with this product, please let us know so we can cite your paper.

Loading...