Recombinant human CD226 Fc-Fusion Protein

Recombinant human CD226 Fc-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

CD226 is involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell. It is a cell surface receptor for NECTIN2, and upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding.

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00123-10.9
Recombinant human CD226 Fc-Fusion Protein
0.1mg In stock
Regular Price:$371.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): CD226 antigen, DNAX accessory molecule 1, DNAM-1
Antigen: CD226
Accession ID: Q15762
Species: human
Fc domain: human IgG1
Host: HEK293
Molecular Weight: 108094.14 Da
Extinction Coefficient: 171400
Amino Acid Sequence: EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGGGGGSEPKSQDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGHHHHHH
Purity: >95% (SDS-PAGE)
Buffer: PBS + 0.02% Proclin 300
Amount: 0.1mg
Activity: Involved in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-lymphocyte (CTL) and NK cell [PMID:8673704]. Cell surface receptor for NECTIN2. Upon ligand binding, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Competes with PVRIG for NECTIN2-binding [PMID:26755705] [Uniprot].
Mycoplasma Tested: <1.0 EU/mg
Storage: Store at 4C up to 1 month. Small volumes at -20C for longer storage.
Shipped: Cold packs

Documentation
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...