Recombinant human NCTR1 Fc-Fusion Protein
Recombinant human NCTR1 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Natural cytotoxicity triggering receptor 1 (NCTR1) is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
From our sister company Absolute Antibody.
Recombinant human NCTR1 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Natural cytotoxicity triggering receptor 1 (NCTR1) is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
Specifications
| Product Type: | Protein |
| Alternative Name(s): | Natural cytotoxicity triggering receptor 1, Lymphocyte antigen 94 homolog, NK cell-activating receptor, Natural killer cell p46-related protein, NK-p46, NKp46, hNKp46, CD335 |
| Antigen: | NCTR1 |
| Accession ID: | O76036 |
| Species: | human |
| Fc domain: | human IgG1 |
| Host: | HEK293 |
| Molecular Weight: | 108318.36 Da |
| Extinction Coefficient: | 160250 |
| Amino Acid Sequence: | QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGGGGGSEPKSQDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGHHHHHH |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS + 0.02% Proclin 300 |
| Amount: | 0.1mg |
| Activity: | Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis [Uniprot]. |
| Mycoplasma Tested: | <1.0 EU/mg |
| Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
| Shipped: | Cold packs |
Documentation
References
If you publish research with this product, please let us know so we can cite your paper.
