Recombinant mouse CTLA4 Fc-Fusion Protein

Recombinant human CTLA4 Fc-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

Cytotoxic T-lymphocyte protein 4 (CLTA4) is an inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00155-1.9
Recombinant mouse CTLA4 Fc-Fusion Protein
0.1mg In stock
Regular Price:$371.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): Cytotoxic T-lymphocyte protein 4, CTLA4, CD152, CTLA-4-Ig, CTLA-4-Fc chimera, CTLA-4 (Fc tag)
Accession ID: P09793
Antigen: CTLA4
Host: HEK293
Fc domain: mouse IgG1
Species: mouse
Extinction Coefficient: 86750
Molecular Weight: 81098 Da
Amino Acid Sequence: SEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH
Purity: >95% (SDS-PAGE)
Buffer: PBS + 0.02% Proclin 300
Amount: 0.1mg
Activity: Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28 [Uniprot].
Mycoplasma Tested: <1.0 EU/mg
Storage: Store at 4C up to 1 month. Small volumes at -20C for longer storage.
Shipped: Cold packs

Documentation
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...