Recombinant mouse CTLA4 Fc-Fusion Protein
Recombinant human CTLA4 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Cytotoxic T-lymphocyte protein 4 (CLTA4) is an inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28
From our sister company Absolute Antibody.
Recombinant human CTLA4 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Cytotoxic T-lymphocyte protein 4 (CLTA4) is an inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
Specifications
| Product Type: | Protein |
| Alternative Name(s): | Cytotoxic T-lymphocyte protein 4, CTLA4, CD152, CTLA-4-Ig, CTLA-4-Fc chimera, CTLA-4 (Fc tag) |
| Accession ID: | P09793 |
| Antigen: | CTLA4 |
| Host: | HEK293 |
| Fc domain: | mouse IgG1 |
| Species: | mouse |
| Extinction Coefficient: | 86750 |
| Molecular Weight: | 81098 Da |
| Amino Acid Sequence: | SEAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS + 0.02% Proclin 300 |
| Amount: | 0.1mg |
| Activity: | Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28 [Uniprot]. |
| Mycoplasma Tested: | <1.0 EU/mg |
| Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
| Shipped: | Cold packs |
Documentation
References
If you publish research with this product, please let us know so we can cite your paper.
