Recombinant mouse CD70 Fc-Fusion Protein

Recombinant human CD70 Fc-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

CD70 binds to CD27 and plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00161-1.28
Recombinant mouse CD70 Fc-Fusion Protein
0.1mg In stock
Regular Price:$371.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): CD70 antigen, CD27 ligand, CD27-L, Tumor necrosis factor ligand superfamily member 7, CD70
Accession ID: O55237
Antigen: CD70
Host: HEK293
Fc domain: mouse IgG1
Species: mouse
Extinction Coefficient: 96830
Molecular Weight: 87590 Da
Amino Acid Sequence: HHHHHHVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLMISLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPILHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGAGGGGSGGGGSSKQQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPAAHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP
Purity: >95% (SDS-PAGE)
Buffer: PBS + 0.02% Proclin 300
Amount: 0.1mg
Activity: Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells [Uniprot].
Mycoplasma Tested: <1.0 EU/mg
Storage: Store at 4C up to 1 month. Small volumes at -20C for longer storage.
Shipped: Cold packs

Documentation
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...