Recombinant mouse TIGIT Fc-Fusion Protein

Recombinant human TIGIT Fc-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

T-cell immunoreceptor with Ig and ITIM domains (TIGIT) binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells.

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00163-1.9
Recombinant mouse TIGIT Fc-Fusion Protein
0.1mg In stock
Regular Price:$360.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): T-cell immunoreceptor with Ig and ITIM domains, V-set and transmembrane domain-containing protein 3
Accession ID: P86176
Antigen: TIGIT
Host: HEK293
Fc domain: mouse IgG1
Species: mouse
Extinction Coefficient: 105320
Molecular Weight: 79961 Da
Amino Acid Sequence: GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH
Purity: >95% (SDS-PAGE)
Buffer: PBS + 0.02% Proclin 300
Amount: 0.1mg
Activity: Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells (By similarity) [Uniprot].
Mycoplasma Tested: <1.0 EU/mg
Storage: Store at 4C up to 1 month. Small volumes at -20C for longer storage.
Shipped: Cold packs

Documentation
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...