Recombinant mouse TIGIT Fc-Fusion Protein
Recombinant human TIGIT Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
T-cell immunoreceptor with Ig and ITIM domains (TIGIT) binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells.
From our sister company Absolute Antibody.
Recombinant human TIGIT Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
T-cell immunoreceptor with Ig and ITIM domains (TIGIT) binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells.
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
Specifications
| Product Type: | Protein |
| Alternative Name(s): | T-cell immunoreceptor with Ig and ITIM domains, V-set and transmembrane domain-containing protein 3 |
| Accession ID: | P86176 |
| Antigen: | TIGIT |
| Host: | HEK293 |
| Fc domain: | mouse IgG1 |
| Species: | mouse |
| Extinction Coefficient: | 105320 |
| Molecular Weight: | 79961 Da |
| Amino Acid Sequence: | GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLGWHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFLKVQESSDDRNGLAQFQTAPLGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS + 0.02% Proclin 300 |
| Amount: | 0.1mg |
| Activity: | Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells (By similarity) [Uniprot]. |
| Mycoplasma Tested: | <1.0 EU/mg |
| Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
| Shipped: | Cold packs |
Documentation
References
If you publish research with this product, please let us know so we can cite your paper.
