Recombinant mouse VISTA Fc-Fusion Protein

Recombinant human VISTA Fc-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

V-type immunoglobulin domain-containing suppressor of T-cell activation (VISTA) is an immunoregulatory receptor which inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signalin, and may stimulate MMP14-mediated MMP2 activation.

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00164-1.9
Recombinant mouse VISTA Fc-Fusion Protein
0.1mg In stock
Regular Price:$371.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): V-type immunoglobulin domain-containing suppressor of T-cell activation, Platelet receptor Gi24, V-set domain-containing immunoregulatory receptor, V-set immunoregulatory receptor
Antigen: VISTA
Accession ID: Q9D659
Species: mouse
Fc domain: mouse IgG1
Host: HEK293
Molecular Weight: 88947 Da
Extinction Coefficient: 97900
Amino Acid Sequence: AFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH
Purity: >95% (SDS-PAGE)
Buffer: PBS + 0.02% Proclin 300
Amount: 0.1mg
Activity: Immunoregulatory receptor which inhibits the T-cell response (PubMed:21383057, PubMed:24743150, PubMed:25267631). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (PubMed:20042595). May stimulate MMP14-mediated MMP2 activation (By similarity) [Uniprot].
Mycoplasma Tested: <1.0 EU/mg
Storage: Store at 4C up to 1 month. Small volumes at -20C for longer storage.
Shipped: Cold packs

Documentation
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...