Recombinant human CD47 (C33 to G mutation) Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
Leukocyte surface antigen CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. It is a receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
Product Type: | Protein |
Alternative Name(s): | Leukocyte surface antigen CD47, CD47-Ig, CD47-Fc chimera, CD47 (Fc tag) |
Accession ID: | P16410 |
Antigen: | CD47 (C33 to G mutation) |
Host: | HEK293 |
Fc domain: | mouse IgG1 |
Species: | mouse |
Extinction Coefficient: | 88360 |
Molecular Weight: | 80515 Da |
Amino Acid Sequence: | QLLFSNVNSIEFTSGNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH |
Purity: | >95% (SDS-PAGE) |
Buffer: | PBS + 0.02% Proclin 300 |
Amount: | 0.1mg |
Activity: | CD47 binds to SIRPA, which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. |
Mycoplasma Tested: | <1.0 EU/mg |
Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
Shipped: | Cold packs |
If you publish research with this product, please let us know so we can cite your paper.