Recombinant mouse CD47 (C33 to G mutation) Fc-Fusion Protein

Recombinant human CD47 (C33 to G mutation) Fc-Fusion Protein expressed in HEK293 cells.

Highlights:

  • Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
  • In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
  • Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners

Leukocyte surface antigen CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. It plays an important role in memory formation and synaptic plasticity in the hippocampus. It is a receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.

From our sister company Absolute Antibody.

Catalog Number Product DataSheet Size AVAILABILITY Price Qty
Kf-Pr00113-1.9
Recombinant mouse CD47 (C33 to G mutation) Fc-Fusion Protein
0.1mg In stock
Regular Price:$360.00
On Sale:

For larger sizes, please Contact Us for a bulk discount.

Specifications

Product Type: Protein
Alternative Name(s): Leukocyte surface antigen CD47, CD47-Ig, CD47-Fc chimera, CD47 (Fc tag)
Accession ID: P16410
Antigen: CD47 (C33 to G mutation)
Host: HEK293
Fc domain: mouse IgG1
Species: mouse
Extinction Coefficient: 88360
Molecular Weight: 80515 Da
Amino Acid Sequence: QLLFSNVNSIEFTSGNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH
Purity: >95% (SDS-PAGE)
Buffer: PBS + 0.02% Proclin 300
Amount: 0.1mg
Activity: CD47 binds to SIRPA, which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation.
Mycoplasma Tested: <1.0 EU/mg
Storage: Store at 4C up to 1 month. Small volumes at -20C for longer storage.
Shipped: Cold packs

Documentation
References

If you publish research with this product, please let us know so we can cite your paper.

Loading...