Recombinant mouse OX40 Fc-Fusion Protein
Recombinant human OX40 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Tumor necrosis factor receptor superfamily member 4 (OX40) is a receptor for TNFSF4/OX40L/GP34 and is a costimulatory molecule implicated in long-term T-cell immunity.
From our sister company Absolute Antibody.
Recombinant human OX40 Fc-Fusion Protein expressed in HEK293 cells.
Highlights:
- Prolongs of the plasma half-life (t1/2) of the protein of interest in vivo, resulting in improved therapeutic efficacy
- In vitro applications of Fc-Fusion proteins include immunohistochemistry (IHC), flow cytometry (FC), protein binding assays, and use as microarray baits
- Fc domain-Fusion can also improve the in vivo and in vitro solubility and stability of some binding partners
Tumor necrosis factor receptor superfamily member 4 (OX40) is a receptor for TNFSF4/OX40L/GP34 and is a costimulatory molecule implicated in long-term T-cell immunity.
From our sister company Absolute Antibody.
For larger sizes, please Contact Us for a bulk discount.
Specifications
| Product Type: | Protein |
| Alternative Name(s): | Tumor necrosis factor receptor superfamily member 4, TNFRSF4, CD134, OX40L receptor, ACT35, IMD16, TXGP1L |
| Antigen: | OX40 |
| Accession ID: | P47741 |
| Species: | mouse |
| Fc domain: | mouse IgG1 |
| Host: | HEK293 |
| Molecular Weight: | 95814 Da |
| Extinction Coefficient: | 115740 |
| Amino Acid Sequence: | GVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGGGGSVPRDQGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTKPREEQINSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITNFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGKHHHHHH |
| Purity: | >95% (SDS-PAGE) |
| Buffer: | PBS + 0.02% Proclin 300 |
| Amount: | 0.1mg |
| Activity: | OX40 is the receptor for TNFSF4/OX40L/GP34. It is a secondary costimulatory immune checkpoint molecule implicated in long-term T-cell immunity. |
| Mycoplasma Tested: | <1.0 EU/mg |
| Storage: | Store at 4C up to 1 month. Small volumes at -20C for longer storage. |
| Shipped: | Cold packs |
Documentation
References
If you publish research with this product, please let us know so we can cite your paper.
