Anti-Lobster Alpha IV Tubulin (OET-10) Antibody
Rabbit IgG polyclonal antibody was raised against peptide and recognizes lobster alpha IV tubulin.
Highlights:
- Reacts with lobster alpha IV tubulin
Microtubules are required for many well characterized functions in eukaryotic cells, including the movement of chromosomes in mitosis and meiosis, intracellular transport, establishment and maintenance of cellular morphology, cell growth, cell migration and morphogenesis in multicellular organisms. The building block of a microtubule is the tubulin subunit, a heterodimer of alpha and beta tubulin. Both of these monomers are found in all eukaryotes, and their sequences are highly conserved. The tubulin protein is a major target of drug molecules, and consequently, tubulin inhibitors have attracted great attention as antimitotic antitumor agents for chemotherapeutic use.
From the laboratory of Timothy S. McClintock, PhD, University of Kentucky.
Rabbit IgG polyclonal antibody was raised against peptide and recognizes lobster alpha IV tubulin.
Highlights:
- Reacts with lobster alpha IV tubulin
Microtubules are required for many well characterized functions in eukaryotic cells, including the movement of chromosomes in mitosis and meiosis, intracellular transport, establishment and maintenance of cellular morphology, cell growth, cell migration and morphogenesis in multicellular organisms. The building block of a microtubule is the tubulin subunit, a heterodimer of alpha and beta tubulin. Both of these monomers are found in all eukaryotes, and their sequences are highly conserved. The tubulin protein is a major target of drug molecules, and consequently, tubulin inhibitors have attracted great attention as antimitotic antitumor agents for chemotherapeutic use.
From the laboratory of Timothy S. McClintock, PhD, University of Kentucky.
| Product Type: | Antibody |
| Antigen: | lobster alpha IV tubulin (OET-10; lobster α-tubulin) |
| Accession ID: | P68366, AAL04106 |
| Molecular Weight: | 51.77 kDa |
| Isotype: | IgG |
| Clonality: | Polyclonal |
| Clone Name: | OET-10 |
| Reactivity: | Lobster (Homarus americanus) |
| Immunogen: | Peptide |
| Species Immunized: | Rabbit |
| Epitope: | MVSGGRECISMHVGQAGVQMGNACWELYCLEHGIQADGGMIMDETEPNQPYIANDSFNTFFNETRMGKHVPRAVFIDLEPSVVDEI |
| Purification Method: | Column purification using Protein A agarose resin |
| Tested Applications: | Untested |
| Concentration: | Unknown |
| Storage: | -80C |
| Shipped: | Cold Packs (Domestic, Overnight); Dry Ice (International) |
If you publish research with this product, please let us know so we can cite your paper.
