SARS-CoV-2 Envelope (E) Protein
This full length, native SARS-CoV-2 Envelope (E) protein with no tags was expressed recombinantly in E. coli.
Highlights:
- Verified by SDS-PAGE, Western blot, and Matrix-assisted laser desorption/ionization (MALDI)
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is a positive-sense single-stranded RNA virus, with a single linear RNA segment, and a strain of coronavirus that causes COVID-19. Like other coronaviruses, SARS-CoV-2 has four structural proteins. The N (nucleocapsid) protein which serves to hold the RNA genome. The other three components are the: S (spike), E (envelope), M (membrane), and N (nucleocapsid) proteins, which together make up the viral envelope.
From the laboratory of Thomas Kuhlman, PhD, University of California Riverside.
This full length, native SARS-CoV-2 Envelope (E) protein with no tags was expressed recombinantly in E. coli.
Highlights:
- Verified by SDS-PAGE, Western blot, and Matrix-assisted laser desorption/ionization (MALDI)
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is a positive-sense single-stranded RNA virus, with a single linear RNA segment, and a strain of coronavirus that causes COVID-19. Like other coronaviruses, SARS-CoV-2 has four structural proteins. The N (nucleocapsid) protein which serves to hold the RNA genome. The other three components are the: S (spike), E (envelope), M (membrane), and N (nucleocapsid) proteins, which together make up the viral envelope.
From the laboratory of Thomas Kuhlman, PhD, University of California Riverside.
| Product Type: | Protein |
| Name: | SARS-CoV-2 Envelope (E) protein |
| Accession ID: | P0DTC4 |
| Source: | E. coli |
| Molecular Weight: | 8365, 75 amino acids |
| Amino Acid Sequence: | MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
| Fusion Tag(s): | None |
| Purification Method: | SDS-PAGE |
| Purity: | >90% by SDS-PAGE |
| Buffer: | 50 mM NaH2PO4, 300 mM NaCl, 10 mM imidizole |
| Storage: | 4C |
| Shipped: | Cold packs |
If you publish research with this product, please let us know so we can cite your paper.
