Recombinant theileria annulata cysteine proteinase (TACP), produced from E. coli.
Theileria annulata cysteine proteinases are the kind of hydrolase and play critical roles in parasite virulence, host invasion, nutrition and host immune response. The recombinant TACP is expressed in E.coli can be used for Theileriosis research studies.
Catalog Number | Product | DataSheet | Size | AVAILABILITY | Price | Qty |
---|
Product Type: | Protein |
Name: | Thaleiria Annulata cysteine Protease |
Source: | Expressed recombinantly in E. coli |
Molecular Weight: | 23 kDa |
Amino Acid Sequence: | MGSGENLNWARTDAVSPIKDQGDHCGSCWAFSSIASVESLYRLYKNKSYFLSEQELVNCDKSSM GCAGGLPITALEYIHSKGVSFESEVPYTGIVSPCKPSIKNKVFIDSISILKGNDVVNKSLVISPTVVGIA VTKELKLYSGGIFTGKCGGELNHAVLLVGEGVDHETGMRYWIIKNSWGEDWGENGFLRLQRTKK GLDKCGILTFGLNPI |
Fusion Tag(s): | C-terminus 6 _ His tag |
Format: | Lyophilized powder. Dilute to 1 mg/mL in PBS |
Purity: | >95 %, purified by Ni NTA and determined by SDS-PAGE. |
Buffer: | PBS |
Tested Applications: | Theileriosis research |
Comments: | Manufactured in an ISO 9001:20015 Certified Laboratory |
Storage: | Store at -20 degree C, for extended storage |
Shipped: | Cold packs |
If you publish research with this product, please let us know so we can cite your paper.